Dive Sites Philippines

The Philippines has more or less everything, and it’s all in warm waters. There are over 7,100 islands surrounded by clear seas and we have hundreds of coral species and even more species of fish. Best of all, the Philippines offers incredibly good value diving in a series of high quality comfortable resorts.



For beginners, the Philippines provides Instructor care with teaching available in all the major global languages. Just imagine doing your first dives on pristine coral reefs and seeing turtles, rays and a whole host of beautiful marine life. The majority of all the resorts have swimming pools, so much of your initial training will take place in a comfortable and easy environment.

We have muck and macro diving here which offers wonderful photographic opportunities, the house reefs around Negros and Panglao are perfect for this. Diving in Apo Island, diving in Apo Reef and diving in Tubbataha Reefs are synonymous with pelagics and here you can see Tuna, Sharks and schools of Jacks and Barracuda. There are steep walls at Pescador Island, Balicasag Island and Cabilao full of sea life and excitement.  Diving in Malapascua you will find one of the few dive sites in the world where you have a good chance to see Thresher Sharks. Diving in Siquijor and diving in Boracay have gentle slopes and very pretty reefs. Boracay also has the famed Yapak wall where big Pelagics will glide past you at 30m deep. Diving in Coron is justifiably famous for its World War 2 wrecks, over 10 Japanese boats lie in waters shallow enough for recreational divers to explore them – all set in a backdrop of astonishingly beautiful scenery. On the north side of Busuanga Island, at Dimakya island, not only can you reach Apo Reef but you can also take the opportunity to dive with dugongs. Puerto Galera has dozens of dive sites within a very short distance of the resorts. Perhaps the best known being Canyons where strong currents will give you an exhilarating ride and Verde Island home to great numbers of fish. Anilao which is just a short dive from Manila is home to great reefs and makes for the perfect weekend or short dive break.

There’s night diving, technical diving, rebreather diving, diving in lakes and so much more that you just have to keep coming back time after time. And all this set in a tropical bliss with warm seas, sandy beaches, green palm trees, fantastic food and drink and friendly people. Your holiday here can be as lively or as quiet as you want it to be, you don’t ever have to travel far to find a deserted cove, beach or tranquil space and yet the impromptu party is always just around the corner!

Lastly, Philippines location means that you are just a short jump to diving in Truk, diving in Palau and diving in Borneo which opens the door to more famous diving locations and the opportunity to combine diving in different countries. Are you looking for Manila Accommodation?


 


Best Dive Sites

'Tapilon' Wreck deepwreck
By Boat - Advanced
The 'Tapilon' is a WWII Japanese wreck nicknamed after a nearby town.  Sunk in battle in 1944 the wreck is badly damaged however artifacts continue to reveal themselves.  Old artillery shells still scatter the site as well as quirky remnants such as war era telephones, Japanese Navy…

7 Islands Reef reef
by boat - all levels
Its local name is Siete Picado, and it is one of the most popular reef dives around Coron because of its close distance to the town (only 20min with the boat). Also good for a single dive or night dive, but usually and best in combination with Barracuda lake. Since a couple of years this reef is a…

Adrian's Cove reefwall
By boat - CMAS ** / AOW
Great wall with coves and overhangs covered with bushes of black coral.

Agnay Sanctuary ambiancereeflagoon
By boat -
Here you will find beautiful coral decorated reefs teeming with marine life. Bonus is that Agnay Sanctuary is situated in a protected bay area, making this dive easy to handle. Calm sea conditions and much to see and explore. A good place to see eagle rays and frogfishes.

Agpanabat Caves & Canyons cavereef
By boat -
Start your dive in shallow waters and gradually slope to a maximum depth of 25 meters to where you will find several swim throughs, caves and reef sections to explore. These underwater structures are teeming with marine life.This spot can be reached in 40 to 50 minutes from Romblon Town or…

Agpanabat Sanctuary ambiancereef
By boat -
This dive site consists of various beautiful coral formations with lots of small fish life such as clownfish, scorpionfish, boxfish and others.This spot can be reached in 40 to 50 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.

Agus reefwall
By boat & from shore - All divers

Agutayan Island reef
by shore/ by boat - all levels
One of the underwater jewels of Mindanao is the diving spots in Northern Mindanao, specifically the waters surrounding the Agutayan Island known as Agutayan Marine Sanctuary, off the coast of Jasaan, Misamis Oriental. The island, virtually a sandbar is surrounded by green waters that is rich…

Airport Point wreckreef
By boat - All divers
The plane wreck has been set here in 1998. Nice second dive.

Akitsushima wreck
By boat - CMAS ** / AOW
Located in between the islands of Lajo and Manglet south of Concepcion village on Busuanga Island, lies the Akitsushima Wreck. One of the few real warships among the Coron wrecks. The Akitsushima was sunk by the Americans in 1944. The wreck is 148m (485ft) long, had 4.650 G.R.T. and lies on port…

Alad Sanctuary garden reef
By boat -
The fish sanctuary of Alad is well known for its endless soft coral fields, barrel sponges and abundant marine life. A true diver’s paradise! Start your dive in shallow waters and gradually slope to a maximum depth of 35 meters. This underwater landscape is teeming with marine life and enveloped…

Alad Sanctuary Slope reef
By boat -
The reef is covered in various soft corals and provides a beautiful and exciting scuba dive. There is some amazing marine life here like puffers, groupers, lobsters, cuttlefish and ribbon eels are just a few. A great place for underwater photography.This spot can be reached in 20 to 30 minutes from…

Alad South reeflagoon
By boat -
This site contains a sandy area with some really interesting sea life and is full of colorful mixed coral species and many reef fish. Alad South hosts a large field of garden eels, too.This spot can be reached in 20 to 30 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12…

Alona Beach Sanctuary reef
By boat & from shore - All divers
This dive sites lies 5 min. by boat from Alona beach. Shallow dive (max. 25m) on a wall with many vertical cuts. Anemones and multicolored corals teeming with life. Small fish, scorpionfishes, frogfishes and nudibranchs. Seasnakes can be found in sandy areas. Best place for a night dive

Ampo Reef reef
By boat - All divers

AN LST wreck
By boat - CMAS ** / AOW
This vessel is situated between Grande Island and the southern tip of the runway, this landing craft lies in 32 meters, sitting upright with its door open. The average dive is 28-35 meters, and the visibility is normally 15-30 meters, slightly deeper than other wrecks and often with slight current,…

Anchor & Christmas Tree reef
By boat - All divers
On a underwater hill at a depth of 32 m, completely overgrown by corals, a huge anchor has come to rest at least 50 years ago. Snappers, barracudas and pelagic fish can be seen. At the bottom of the hill is a tree-like sea nettle, all white.

Angels Cove deepreefwall
By boat - CMAS * / OW
Large tunas, mackerels and jack. Good soft and hard corals.

Angol Point reef
By boat - All divers
This is an excellent dive site for beginners and training dives. The reef is covered with stony corals, leather corals, nudibranchs, anemones, sea stars and sea cucumbers. It is also a favourite for night dives and is a good spot for macro photography. Good for snorkelling, too.

Antina Point cavereefdriftwall
By boat & from shore - CMAS ** / AOW
Take care of the strong currents that may occurs in this dive site!

Apit Island deepreefsharkswall
By boat - CMAS ** / AOW
Dolphins, sea turtles, seahorses...

Apo Reef wall
By boat - CMAS * / OW
Famous for its dramatic drop-offs down to 400 metres, the steep walls of Apo reef (not to be confused with Apo Island, Dumaguete) are covered with corals, sponges, tunicates, nudibranchs and slugs. Green and hawksbill turtles and a multitude of fish including damselfish, butterfly fish, batfish,…

Arco Point cavereef
By boat - All divers
Located near the exclusive Bohol Beach Club, Arco Point is also known as the "Hole in the Wall" because there is a vertical funnel which you can enter at 9m and exit at 18m. Along the short wall, you can come across small groupers, trigger fish, wrasse, butterfly fish, sea snakes and moray eels. The…

Arena Island reef
by liveboard - all levels/ AOWD
Arena island, 89 km northeast of the Tubbataha reefs and Cavili close by are small coral islets and sand cays with fringing reefs. Arena has a lighthouse and seaweed farms. Further north lie Caluse and Cagayancillo, both surrounded by reefs. This whole area is not so nice to dive, since there has…

Ariara House Reef reef
By boat - CMAS ** / AOW

Ariara Reef reef
By boat - CMAS * / OW

Atlantis Reef reef
By boat & from shore - All divers

Baby Shark
By boat - All divers

Bacong reefwall
By Boat - All divers
Here the steep wall is densely populated by corals. In limits suitable for beginners, because of the depths and currents. on the other side this spot is full of life. Chances of turtles.

Badian Island West reefwall
By boat - CMAS * / OW

Bahura reef
By boat & from shore - All divers

Bahura ambiancereeflagoon
By boat - All divers
Part of the eastern limit of the Balabac Marine Reserve, a beautiful coral area rich in fauna and flora. However dive must be performed timely with highest tide. Fishing restricted. RA8550.

Balinghai sharkswall
By boat - All divers
Balinghai is two walls running parallel to each other. The deep wall features sharks and tuna while the shallow wall is pockmarked by small holes which house anthias, lionfish, triggerfish, bannerfish, puffers and gobies.

Banayan Point (Matinloc Island) bigfishesreef
by boat - all levels
Situated on the southern tip of the island, this a great site to see pelagics. Currents can be strong, bringing with them tuna, jacks and mackerel. Don't be so busy viewing the fish that you miss the coral encrusted rocks.

Banca Wreck
By boat - All divers

Bangug Island reef
By boat -
Bangug Island is a small reef system running parallel to the island and ending in a maximum depth of 20 meters. Start your dive in a depth of 2 meters and gradually make your way to the sandy bottom. In the sea grass fields and under the blocks there is a lot to discover. Suitable for all level…

Bannerfish Point deepwall
By Boat - AOW
Bannerfish Point is named after the hundreds of Bannerfish that patrol this section of wall.  The site is also home to many varieties of reef fish including Boxfish, Red Tooth Triggerfish, Titan Triggerfish as well as Pelagics like Trevally, Tuna and Spanish mackerel.  Thresher Shark,…

Bantigi reef
By boat - CMAS * / OW
This is a great muck dive - some divers have told us that Bantigi is even better than Lembeh!. It starts as a shallow reef that turns into a sandy bottom at around 12m where you can find all kinds of unusual creatures. There are goby and shrimp living together in holes everywhere and the tiny rocks…

Barracuda Deep wall
By boat - All divers
Probably the most advanced dive around the island. A wall at 30 m depth facing the South China Sea is the place to see big schools of trevallys, fusiliers, surgeon fish, spanish mackerels and unicorn fish. Eagle rays and napoleons are often seen as well as barracudas up to a size of 1,5 m. The whole…

Barracuda Lake ambiancefreshwater
By boat & from shore - All divers
Located in the middle of the north-west coast of Coron Island further inland, the access is by boat. In the north-west coast of Coron Island there's a cave with limestone cliffs, exactly between Pimaa Point and Balolo Point. In the middle of the bay there is a gap in the cliffs at sea level. You…

Barry's Reef reef
By boat - All divers
This elongated submerged reef is located in a large cove that is about 20 minutes away from the Club. The top of the reef is at 3 to 4 meters ( 12 feet) and the slope sharply drops to 27 meters (90 feet). There are plenty of macro subjects on this reef. Spanish dancers, juvenile spotted sweetlips,…

Bas Coral reefwall
By boat - CMAS ** / AOW
Current may be strong sometimes... Take care!

Bas Diot reef
By boat & from shore - All divers

Bastera Reef & Oceanic Wreck wreckreef
by liveboard - cmas**/ AOWD
Bastera (Maeander Reef) is a sand cay 93 km southwest of Tubbataha south island. The wreck of the Oceanic lies on the east side. Bancoran island, a further 60 km southwest of Bastera, is densely wooded and inhabited.

Bat Cave cave
By boat - CMAS ** / AOW
This dive site is a series of small caves leading to the actual Bat Cave which is also accessible by land. Conditions must be just right to dive here, since waves usually pound against the rocks and swift currents can take you offshore. Lobsters, sea snakes and of course, the bats overhead can make…

Batangas ambiancebigfishesdeepwreckreefsharksdriftwall
Boat and shore dives -
There are atleast 15 dive sites around Anilao.

Batangas Channel driftwall
By boat - All divers
A good drift dive on the right tide this dive site has many unusual sponge and coral formations and is a good place to find some more unusual creatures such as blue-ribbon eels, crocodile fish and stonefish.

Beach Night Dive ambiance
shore - All divers
The beach is a little-known treasure trove for divers with a sharp eye. It is a sandy area with patches of sea grass and hard corals. Watch out for flounders, crabs, nudibranchs, squid and pipefish.

Beatrice Rock shoalbigfishesreefsharks
By boat - CMAS * / OW

Biet Point (Miniloc) reef
by boat - all levels
This site is on the southern tip of the island and ranges from 13-21m. There are plenty of lettuce corals and sponges. You'll encounter jacks, barracuda, squid, cuttlefish and angelfish. The site is very sheltered, so it's a good all year round spot to explore.

Bikanayos Rock (Matinloc Island) ambiancebigfishes
by boat - all levels
Also known as Picanayas, on the western side of the island, the site has some large boulders that whitetip sharks frequent. Pelagics can often be seen here as well.

Biton Resort Housereef wall
By boat & from shore - All divers

Black forest ambiancebigfishesdeep
By boat & from shore - CMAS ** / AOW
Black forest is the main attraction of Balicasag island. it is a steep sandy slope that reaches to a depth of over 40 meters. Starting in deeper waters, you'll find forests of black corals, and can find large groupers, Napoleon Wrasse, barracuda, tuna, snappers, and batfish. Going up, the black…

Black Island wreck wreck
By boat - All divers
It is located in the east side of Malajon Island, alias Black Island due to its black rocks. The wreck is right in front of the beach next to a ship stranded on the shore. The 45m (148ft) long coastal ship of unknown origin lies upright on a sandy slope. The bow at 32m (105ft) and its stern at 20m…

Block #1 bigfishescavedeepreefsharksdriftwall
By boat - CMAS *** / Rescue

Blue Hole cavereefwall
By boat - CMAS ** / AOW

Blue Hole cavedeepwall
By boat - CMAS ** / AOW
This scuba dive consists of a chimney within the reef which leads to a cave at 27 meters where you might find sharks resting. There are some amazing coral features and some small marine life which takes refuge among the corals. You might see some interesting fish like stonefish and…

Bohol Beach Club ambiance
By boat & from shore - All divers
Shallow dive (max. 25 m) on a wall. Sandy area on the bottom. There is a small cave here with a school of cardinalfishes inside. There is a hole in the roof and the light inside is beautiful. You can find some very nice flatworms and nudibranchs in the cave. Go there when there is no other group of…

Boluarte
By boat - All divers

Bonbon Beach reeflagoon
By boat & from shore - Introductory dives and OW
Very spectacular and very colorful dive with lots to see. Starting in shallow water of 3 meters, Bonbon gradually slopes down to a depth of 25 meters to where you can explore this beautiful reef with a mixture of hard and soft coral displays and teeming marine life. Great site for macro…

Bonbon Sea Grass valley reef
By boat -
This dive consists of a series of large rock boulders set in a sea grass plain. Bonbon Sea grass Valley is well known for its great underwater ambience. Suitable for all level divers. This is a good place to find hidden smaller animals and provides great photo opportunity.This spot can be reached in…

Bonito bigfishesreef
By boat - CMAS * / OW
Marine sanctuariy with great marine life.

Bonnie's place reefsharkswall
By boat - CMAS ** / AOW

Bouranga bigfishesdeepdriftwall
By boat - CMAS ** / AOW
Very nice wall dive

Buchok's Reef reef
By boat - All divers
A series of large coral mounds with nice selection of marine life: giant reef rays, small white tip sharks, unicorn surgeons, snappers and sweetlips. For experienced divers only.

Bugor-Reef reef
by boat - all levels
This excellent reef near the north-shore of Culion Island slopes from 3m down to 35m+.It usually offers a quite good visibility of 15-20m. The best parts are the shallow ones with a plenty of different species of hard and soft corals and a rich fish life, including the common reef-fishes like…

Bugtong Bato reef
By boat - CMAS ** / AOWD
Bugtong Bato is an underwater pinnacle, very near Malapascua. There is a large school of batfish is residence as well as squid, mackerel, nudis, scorpionfish, lionfish, zebra crabs and whip coral shrimp.

Bujong Shoal shoaldeepreefsharkswall
By boat - CMAS ** / AOW
The top of the shoal is approx 10m deep, then a nice wall on the southeast down to 45-50m.

Bulias Shoal shoalbigfishesreef
By boat - CMAS * / OW
balck corals, manta rays (depending on season), barracudas, jacks...

Calanggaman Island
By boat - CMAS ** / AOW
Calanggaman Island is the picture postcard desert island, actually chosen from over 7,000 islands to grace the cover of Jens Peters - the definitive Philippines Travel Guide. Calangaman Island is palm trees and a pile of white sand surrounded by crystal clear water and steep walls dropping off…

Cambaquiz
By boat & from shore - All divers
This is a very nice dive just in front of the village. Wall down to 30m with a small cave. The sandy part in between the reefs is easy to find a double-ended and an ornate pipefish.

Camia II wreck
By boat - CMAS ** / AOW
The Camia II, once a steel hulled fishing vessel, was sunk in January 2000. It rests on the bottom at 30 meters with its wheel house at 20 meters. It has since developed very nicely as an artificial reef. The sealife include large red bass, bluefin trevallies, scorpion fish, school of batfish,…

Camia Wreck wreck
By boat - CMAS ** / AOW
The Camia is Boracay’s house wreck. It is a 30 metre-long cargo boat that was sank as a Fish Attraction Device in January 2001. It has since developed very nicely as an artificial reef. The residents now include a couple of huge red bass, some bluefin trevallies, scorpion fish and a school of…

Capitancillo Island ambianceshoaldeepreefsharkswall
By boat - CMAS ** / AOW
Very nice wall running from 30m to 50m deep; with large gorgonian fans, puffer fishes and schools of fusiliers.

Car Wreck wreck
By boat - All divers
A sandy place for looking at critters, sea horses, frog fishes and more

Carmen's Cliff bigfishesreefsharkswall
By boat - CMAS * / OW
This spot is located next to a huge rock in the ocean. You can see numerous species of marine life between the diverse coral communities at a vertical wall. Beside swarm fish you can find sharks, mantas and eagle rays.

Cathedral Cave ambiancecavereef
By boat - CMAS ** / AOW
The entrance is located north north-east of Calis Point on Coron Island where some overhanging cliffs lead to small grottoes and holes. Once you've found the big cave entrance you have to find the narrow tunnel in the bottom leading to the cathedral cave. This is an excellent diving excursion. You…

Cathedral Rock ambiancereef
By boat & from shore - All divers
Cathedral Rock is one of the most popular dive sites in the area. Approximately 23 meters off Bagalangit Point lies a giant rock formation that looks like a roofless underwater amphitheatre. Originally barren, the Cathedral has been seeded with corals from other sites and now it is home to Moorish…

Cathedral wall cavereefwall
By boat & from shore - All divers

Cervera Shoal shoal
By boat - All divers
Cervera Shoal, is also known as "Snake Island" or "Spagetti Shoal". The shoal gets its name from the large number of balck-and-white-banded sea snakes that can be seen here. Don't expect to see corals here, but it does makes a nice dive, with a good change to see a sea snakes and large pelagic fish.…

Cesar's Reef reef
By boat - All divers
Tiny reef area with bounded coral covers. Rich with large fish such as napoleon wrasses (Chiefly tropical marine fishes with fleshy lips and powerful teeth; usually brightly colored), tuna and parrot fish. View schools of surgeon fish, barracuda (Any voracious marine fish of the genus Sphyraena…

Challenger Reef reef
By boat - All divers
The reef area is almost half the size of Aligua, its top is about 125 feet deep, with soft coral growth. The northern part of the island has short walls and a long narrow opening and a few juvenile fish.

Challenging caves cavedeep
By boat - CMAS ** / AOWD
Challenging caves accessed by tunnels await you to explore at a depth ranging of 125 feet (38 meters). You can enjoy other small caves along the way down the vertical walls at a depth ranging from 42 to 88 feet (13 to 27 meters) in Twin Islands. There are beautiful soft and hard coral formations and…

Chameleon reef
By Boat - All divers
Much suitable for beginners. The name is derived from the frequently changing look. Sometimes wall, sometimes slope. Many nice impressions. Many young fish and plenty naked snails

Channel of Alad reefdrift
By boat - CMAS ** / AOW
This dive consists of sandy bottom with coral formations. There are often strong currents present which make this perfect for a drift dive. Marine life here includes lots of lobsters and moray eels.This spot can be reached in 20 to 30 minutes from Romblon Town or Lonos, Romblon. This spot can be…

Channel Steps drift
By boat - CMAS ** / AOW
Strong tidal currents flow through the strait, taking divers on a joy ride through canyons and crevices. Coral growth here is very impressive and occasionally white tip sharks and trevallies are sighted. Great site for drift diving. Photography is not possible due to high current's velocity - images…

Chapel reef
By boat & from shore - All divers

Charlys Reef reef
By boat - All divers

Chocolate Island reef
By boat - All divers
Chocolate Island is a beautiful shallow dive site and a macro photographer’s delight. The healthy soft coral is home to a large variety of life: sea snakes, snake eels, moray eels, cuttlefish (including flamboyants), seamoths (Pegasus), large crabs and juvenile batfish. Macro includes nudibranchs,…

Climaco reef
By boat & from shore - CMAS * / OW

Cobrador Sanctuary reef
By boat - CMAS * / OW
This site contains a sandy area and coral formations with some really interesting sea life.

Coco Grove reef
By boat & from shore - All divers

Coco White wall
By Boat - All divers
Simple dive site with nicely populated steep wall. Suitable for beginners when observing the depths limits. Giant shells, Sergeant Majors, Naked snails, Spanish dancing snails, barracuda etc.

Coconut ambiancewreckreefsharks
By boat & from shore - All divers
Don't miss the large schools of barracudas!

Coconut point reefdrift
By boat - CMAS ** / AOW
The current may be very strong in this area. Take care! Only for diver with current experience.

Cogon reefdrift
By boat - CMAS ** / AOW

Constancia Reef deepreefwall
By boat - CMAS ** / AOW

Copton point wreckreefwall
By boat - CMAS ** / AOW
THere is an airplane at 20m deep, just at the wall edge.

Coral Garden reef
By boat - All divers
This dive site is right off the main beach and usually has calm and clear conditions. It is ideal for beginners and training dives. It is a popular fish-feeding area, so expect to see sergeant majors, butterflyfish and batfish crowding around. A favourite snorkelling spot.

Coral Garden reef
By boat - All divers
Nice slope and fantastic coral garden with numerous coral species. Some Pygmee seahorses may be found near 30m deep.

Coral garden reef
By boat - All divers
It is located some hundred meters north-west of Calis Point, which is the southern tip of Coron Island. First you get to a beautiful coral garden and then you descent at the slope to 40m (131ft) or deeper. The flat roof of the reef is covered with marvellous stony- and soft corals, among them big…

Coral Garden Camiguin reef
By boat - All divers
Soft and hard corals, sea snakes,mandarin fish at night fall.

Coral Garden Davao reef
By boat - All divers
Sandy slope with good hard & soft corals. Eels, parotfish, napoleon...

Coral Garden East ambiancereef
By Boat - CMAS * / OW
In Cobrador Island, This beautiful site contains different coral formations with some really interesting sea life. This is a good place to find hidden smaller animals like the ghost pipefish, special shrimps, nudibranchs and scorpion fishes. With enough luck you find sea snakes, turtles and…

Coral Garden East and West reef
By boat - All divers
Another easy but beautiful dive. In a lively garden of hard and soft corals all kinds of marine life can be observed such as surgeon fish, trigger fish, coral trouts, stingrays, moray eels, sand eels, cuttle fish and an occasional turtle. In the deeper parts of the dive, large gorgonians and Neptune…

Coral Garden West reef
By Boat - CMAS * / OW
In Cobrador Island, As the name suggests, this site was named for the beautiful anemone and coral formations outlining this spectacular reef system. Dropping to a depth of only 30 meters into calm waters, this site is suitable for all level divers.This spot can be reached in 30 to 40 minutes from…

Coral Gardens reef
By boat - All divers
Considered the best snorkeling in the area and a great dive for novices and photographers, it can also be an exhilarating drift dive from Manila Channel to Batangas Channel. Coral strewn terrain shelves out from the beach to 9m/27' where large coral heads can be found on a sandy bottom. Some of the…

Coral Reef reefwall
By boat - CMAS * / OW
Similar as Agus dive site.

Coron Island Fishing Boat wreck
By boat - All divers
Located a few hundred meters south-west of the bay entrance to the Barracuda Lake, exactly between Limaa Point and Balolo Point at the north-west coast of Coron Island there is a fishing boat wreck. Here you find some areas for diving and snorkeling with beautiful rocks and sandy coves. Most of the…

Costa Bella reef
By boat & from shore - All divers
Interesting stuffs between 10m and 20m.

Cresta de Gallo bigfishesreefwall
By Boat - CMAS * / OW
In Cresta de Gallo island, This large reef contains some interesting features including some outcrops and shelves. The minimum depth of the reef is around 5 meters and slopes down to some interesting coral features. There are Lobsters, Sweetlips, turtles and more. Beside swarm fish you can find…

Crocodile Island reef
By boat - All divers
From a distance, this small uninhabited island looks like the head of a crocodile. Currents can be fierce except at slack tide, which makes for a beautiful collection of corals. It is a gently sloping wall with several canyons and caves containing a wide diversity of fish.

Crossing reef
By boat - All divers
This reef is a natural submerged bridge between Dimakya Island and Islang Walang Langaw.The reef is about 2 to 3 kilometers long(about a mile). This reef can account for three to four dive spots and each spot can be a different experience for the diver. The main distinguishing characteristic of this…

DALL Reef reef
By boat - All divers

Dap Dap reefwall
By Boat - All divers
Relatively shallow dive, suitable as second dive of the day. Best suitable for beginners or as introduction on the first day of your vacation. Nicely populated steep wall. Occasionally barracudas, but more the tiny things. Many tiny naked snailes and sea spiders, chances of schools of hump head…

Daquit Shoal shoalreef
By boat - CMAS * / OW
Top of the shoal is only 5m deep.

Daryl Laut wreckreefsharkswall
By boat - CMAS * / OW

Dauin Sanctury reef
By boat & from shore - All divers

Dauin South reef
By boat & from shore - All divers

Deep Rock reef
By boat - CMAS * / OW
Deep rock is 5 minutes from Malapascua. It starts at 5 meters and slopes down to 22m. It has frogfish, nudis, pygmy seahorse, robust ghost pipefish, juvenile batfish, harlequin sweetlips, spotted leather coral cowries and and bigger black cowries.

Deep Slope ambiancereef
By Boat - OW or AOW
Deep Slope is a mixture of sandy bottom, reef and wall.  Starting at a mooring in 10m the site slopes towards the deepest point at about 24m.  The site is home to Pygmy Seahorses on a number of fans, Xeno Crabs, Crinoid Shrimp, Harlequin Shrimp, Sea Snakes and abundant reef fish.

Didjo Island deepreefwall
By boat - CMAS ** / AOW

Dilumacad Island cave
by boat - cmas**/ AOWD
Situated 6 km west of El Nido, this island is best known for a cave dive that can be found on the north side. The entrance is wide enough for two divers to enter together and a 15-20m tunnel leads to a cavern at the centre. The bottom is sandy where small fish and crabs can be seen.The way out is…

Dimakya Island reef
From shore - All divers
The Dimakya island house reef provides ample opportunity to spot a huge variety of reef fish and schooling fish, as well as sponges, seastars, sea cucumbers, turtles, cuttlefish and giant clams to name but a few, making this also an excellent place for a snorkelling enthusiast.

Dimakya North reef
By boat - All divers
On the north side of the island is a gently sloping reef. The corals are not as colorful as in the classroom but the chances of seeing mantas, eagle rays, and marine turtles are greater in this area, as well as lobsters and a great assortment of reef fish call this home.

Dimakya North-East reef
By boat - All divers
The northeast end of the island features a small place that has quite a number of Porites (hump corals), some of them as big as a small one bedroom house. The place is a good spot for macrophotography: nudibranchs, crinoids, slugs, and other various invertebrates proliferate in this reef.)

Dimakya West reef
By boat - All divers
On the west side of the island, right in front of the lounge is a reef with a beautiful coral garden. The reef features soft and hard corals in an explosion of colors, amazingly tamed reef fish, and untold surprises. On the steep slope, which runs down to 17 meters (about 55 feet), there are alot of…

Divers heaven cavereefwall
By boat & from shore - CMAS ** / AOW
Just southwest of the town of Panglao on Panglao Island in Bohol (and northeast of Balicasag Island) is a sunken Eden of a dive site divers call “Heaven.” If we want everything the deep sea can reveal all in one spot, it’s got to be Heaven. Steep wall from 5 to 40m deep, with nice coral…

Dog Drift bigfishesdeepdriftwall
By boat - CMAS * / OW

Dolphin House cavereefwall
By boat - CMAS * / OW

Dona Marilyn Wreck wreck
By boat - CMAS ** / AOW
The Dona Marilyn was a Cebu-Manila passenger ferry that sank in a typhoon over 20 years ago. It was a huge disaster and many people lost their lives. The wreck is around 100m long, and now lying on its starboard side, amazingly still all in one piece. Long lost fishing nets encrusted in coral are…

Duljo Point driftwall
By boat - All divers
Duljo Point is the southwestern point of Panglao Island. Although normally calm, this site can be rough with strong currents. Normally, divers will make drift dive here along the edge of a sandy slope at about 10 meters to a drop off down to 40 meters. The wall is covered with sponges, colorful…

Dumunpalit Island reef
By boat - CMAS * / OW
Great site with pink soft corals from the shore to 25m deep. Pelagic species can be found along the slope. No accomadations exist on this island except for the guards that live there. However, if divers wish to camp on the island overnight, they may submit a request. Rate for camping is $55 per…

Dungon Wall wreckwall
By boat - CMAS ** / AOW
Easy multilevel dive. A wreck sits in 27m/90' at the bottom of the wall. The wall rises to 12m/40' where the bottom extends into the bay for an easy safety stop. Good area to for a lot of colour and all Puerto's regular reef life.

East Tangat Gunboat wreck
By boat - CMAS * / OW
Pretty close to the east-shore of Tangat–Island, you can dive a small, 35m long Japanese anti-submarine-chaser and Tug-boat in shallow water of min. 3m down to max 19m. A perfect dive for beginners or a 3.rd dive of the day, and of course, for underwater-photographer! Her original Japanese…

El Capitan wreck
By boat - All divers
The wreck is situated near the inner channel marker of Ilanin Bay. A small freighter, the El Capitan lies on its port side with its stern in 5 meters while its bow rests in 20 meters. Starting the dive from 18 meters there's a nice swim through the accommodation area and one can expect to encounter…

Eldorado Housereef reef
From shore - All divers

Ernie's Caves cave
By boat - CMAS ** / AOW
Ernie was a large lone grouper, sadly departed. There are two caves, one at 21m/70' and the other at 27m/90'. Plentiful fish life, including shoals of surgeonfish, unicornfish, fusiliers and snappers and some very pretty gorgonian fans at depth. Current can be strong.

Eskuelahan shoalreef
By boat - All divers
Named for the numerous schools of fish (snappers, jacks, rainbow runners, surgeons, etc) and occasional tuna found in the area. It is a center of activity with fish of all sizes feeding. Giant frog fish have been also sighted. Currents may be a problem for novice divers.

Evolution's House Reef ambiance
by shore - all levels
Our very own house reef is one of the best muck dives in the country.  Just 3 minutes from our beach front is an incredible array of macro delights.  Here we repeatedly see pairs of Crinoid Squat Lobsters and Imperial Shrimps.  At dusk dozens of Bobtail Squid appear.  Coconut…

Fallen tree reefwall
By boat & from shore - All divers
Nice wall with gorgonian sea fans and black corals. Sometime you can see turtles here... If your lucky you will see the school of Big eye jacks and Barracuda in one dive. If the current picke up, you wil see Tunas, Mackerel and lots of snappers.

Fish Sanctuary reefwall
By boat & from shore - CMAS ** / AOW
This is a protected marine site, with large jack shoals.

Friday's Rock reef
By boat - CMAS * / OW
A dive at Friday’s can actually cover two dive sites: Friday’s Reef which is 7 to 12 meters, and Friday’s Rock which is 12 to 18 meters. This famous fish-feeding station is a large boulder which provides photographers a chance to capture close-up shots of emperors, triggerfish, red bass,…

Garden Eels reefwall
By boat & from shore - All divers
This is a steep wall rated as an easy dive. At a depth of only 8 meters this Bohol diving spot shows off fascinating nudi branches, wrasse, Groupers. At 25 meters it hits rock bottom where various remarkable eels, like sand and garden eels, flourish from the slope to the sandy sea floor. It is ideal…

Gato Island reef
By boat - CMAS * / OW
Gato Island is one of our most famous dive sites. TSD's famous saying is that "You come to Malapascua to see the thresher sharks, but you leave remembering Gato". Gato is a marine reserve and sea snake sanctuary. It has at least five dive sites with a huge diversity of marine life. We are…

Gato Island - Houseguard reef reef
By boat - All divers
Drop down to 24m to find the extremely rare pygmy seahorse, both pink and yellow as well as spider crabs and cowries. Then work your way back along a wall where you can find lionfish and many nudibranchs, including the beautiful spanish dancers, up to 30cm long. Painted frogfish are often in…

Gato Island - The Cave cave
By boat - CMAS ** / AOW
This L shape cave is really great. The Cave, or more accurately, "The Tunnel". Journey underneath Gato Island and come out the other side! This 30m tunnel houses all the usual cave dwellers: many types of crab big and small, lobsters and cardinal fish. You should also encounter some large puffer…

Gato Island - The Wall wall
By boat - CMAS * / OW
Large boulders and a very nice small wall close to the island.

Gato Island - West reef
By boat - CMAS * / OW
Pygmee seahorse, sea snakes, gorgonians and black corals... A very nice dive.

Gato Island: Cathedral cave
By boat - CMAS * / OW
Explore some of the more amazing rock formations around Gato, including the stunning Cathedral rock. This is a great place to see sharks - we have seen as many as 15 whitetips circling. It is also possible to see blue-spotted rays.

Gato Island: Nudibranch City reef
By boat - CMAS * / OW
As the name implies, we find nudibranchs galore at this site. Also around are lots of hermit crabs and scorpion fish.

Gato Island: White Tip Alley reef
By boat - CMAS * / OW
You are 95% guaranteed to find whitetip sharks sleeping under rocks, and if you are lucky you will see them circling. They grown to huge sizes - sometimes over 2 meters. Other life here includes banded boxer shrimp, nudis, seahorses and scorpion fish, spider crabs, frogfish, lionfish and whip coral…

Giant Clam Sanctuary reef
By Boat -
Located in a protected bay next to Tiamban Beach, this dive site consists of a sandy bottom with lots of giant clams.This spot can be reached in 10 to 15 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.

Gimmon Place reef
By boat & from shore - All divers

Ginama Point reef
By boat & from shore - All divers

Gorgonia wall cavedeepreefwall
By boat & from shore - CMAS ** / AOW
Great wall with big Gorgonians. Small caves and overhangings.

Grassland ambiance
From shore - All divers

Guindauahan Island reef
By Boat -
An exciting large reef with various interesting formations and an outstanding display of corals and marine life including turtles, rays, eels, Scorpionfish and more. Outstanding bottom topography makes for great photo opportunity.This spot can be reached in 80 to 90 minutes from Romblon Town or…

Gunter's wall deepreefwall
By boat - CMAS ** / AOW
Wall covered with large black corals. A series of large rock out crops away from the main reef wall.Huge gorgonian fans, big bushes of black coral, sponges, tunicates, excellent hard coral coverage. Turtles, Emperor Fish, schools of Snapper and Fusilier, Bat Fish, Garden Eels, Nudibranchs, Ornate…

Habagat Wreck wreckreef
By boat - CMAS ** / AOW
Habagat Wreck dive site at Danao Beach off Panglao Island in Bohol, being rated as an easy dive, is ideal for snorkeling. At only a depth of 8 to 12 meters this Bohol diving site reveals interesting cardinal, lion, and bat fish. Further down the steep slope, at 35 meters, a boat wreck appears, which…

Hadsan reef
By boat & from shore - CMAS * / OW

Heaven's gate deepreefsharks
By boat - CMAS ** / AOW
Steep slope with sponges, soft corals and anemones. This is a fantastic coral garden with a lot of fishs.

Helmuth Reef reef
By boat - All divers

Hilutungan Island reefwall
By boat - CMAS * / OW
This is the best dive of Mactan area. Don't miss it!

Hinukilan Island deepreefsharkswall
By boat - CMAS ** / AOW
There is almost 5 dive sites around the Island, but this is forbidden to dive here as this island has become a marine sanctuary. This is a good dive site for snorkelling.

Hole in the Wall ambiancereefwall
By boat - All divers
Situated on Escarceo Point, this dive is typically performed as an 18m/60' profile. Allowing for currents you drop into 9m/30' of well-lit water, with fields of table corals as good as anywhere in the world. You descend in several stepped drop-offs, each about 3m/9' and reach The Hole at about…

House Reef reef
By boat - All divers
Good night dive spot. Turtlesn cuttle fish (night) and a lot of sea slugs and shrimps.

House Reef reef
Shore - beginners
Depths between 2 - 20m. Ideal for beginners or a warm-up dive. A wide variety of coral fish such as parrot fish, butterfly fish, trigger fish and sergeant major can be seen. Nearby 'lion fish den' consists of a couple of rocks overgrown with soft and hard corals and teeming with lion fish.

House Reef North reef
From shore - All divers

House Reef West reef
From shore - All divers
Is one of the two house reefs of Coco Loco

Ina's Place lagoon
By boat - All divers
ideal place for check dive

Inbogal Point (Matinloc Island) reef
by boat - all levels
Just to the southwest of Bikanayos, this site has some impressive gorgonians and green corals on a slope to 35m. Jacks, tuna and mackerel are common and it is home to a unique species of angelfish (Pomacanthus annularis). Only here and at Tres Marias can this fish be found.

Irako wreck
By boat - CMAS ** / AOW
Located in the south-east of Lusong Island south of the Kogyo Maru, the Irako, a Japanese supply ship, 147m (482ft) long with 9.570 G.R.T., was sunk in this furious strike of the American Air force in September 24, 1944. The Irako, a provision-vessel for refrigerating food, sunk after disastrous…

Isla Reta reef
By boat - All divers

Island Walang Langaw reef
By boat - All divers
South: The name, literally translated into English means ISLAND WITH NO TREES, is located on the east side of Club Paradise, just ten minutes away by boat. The reef consists of extensive hump coral formations on a shallow, gently sloping terrain. The reef starts at 3 meters(10 feet) and ends at…

Island Walang Tao reef
By boat - All divers
North: This short but beautiful reef can be reached by a 15 minute boat ride from the resort. This island's name in English is THE ISLAND WITHOUT PEOPLE. The reef gently slopes down to 18 meters (60 feet), is home to one long black tip shark and on occasions, 2 meter (7 foot) nurse sharks patrolling…

Japanese Wreck deepwreck
By boat - CMAS ** / AOW
Situated on a flat sandy bottom, all that remains of this WWII Japanese patrol boat is the engine block and propeller shaft. Two very large moray eels are resident, along with 30+ sweetlips. A large orange stonefish is also hidden amongst the engine along with a wealth of small invertebrates. A…

Jessie Beazeley Reef shoalreef
by liveboard - cmas**/ AOWD
The name of this reef is also written as Jezzly Beazley on some maps. This reef lies about 23 km northwest of the Tubbataha reefs but is not protected as a Marine Park, so fishing is allowed here. The reef here is so small, you probably have visited it in two dives. This place is not sheltered at…

Jessie Beazley North End reef
By boat - CMAS ** / AOW
Gradual slopes are rich in corals. There is also a drop-off which is undercut, giving the reef the overall shape of a mushroom. Shark sighting is guaranteed on any dive, with barracuda and Spanish mackerel as common visitors. Currents in the area can change direction within minutes.

Jessie Beazley Reefshark Point reefsharks
By boat - CMAS * / OW

Jessie Beazley White Sand Cay reef
By boat - CMAS * / OW

Jessie Beazly South End reef
By boat - CMAS ** / AOW
Gradual slopes are rich in corals. There is also a drop-off which is undercut, giving the reef the overall shape of a mushroom. Shark sighting is guaranteed on any dive, with barracuda and Spanish mackerel as common visitors. Currents in the area can change direction within minutes.

Jigdup Reef bigfishesreef
By boat - CMAS * / OW
Reef slope down to 30m deep. Black corals, large sponges, mantas (in season), frog fish, Hawkbill turtles...

Jigdup Wall ambiancebigfishescavedeepreefwall
By boat - CMAS ** / AOW
Great wall from 6 to 45m deep; some small caves and a lot of fish shoals! Barracudas, fusillers, snappers, jacks...

Jozef Reef reef
By boat - CMAS * / OW

Junes Reef reef
By boat - All divers

Kabila reef
By boat - CMAS * / OW
Reef slope

Kalambuyan Reef reef
by boat - all levels
A 30min boat ride in the north–west of Okikawa maru this dive-site is one of the best reefs in the region and offers you a beautiful, healthy environment under water with usually pleasant visibility and an excellent diversity of corals and fishes. It is also very good for…

Kalipayan reefwall
By boat and Shore: Just off Alona Beach - All divers
Kalipayan is the house reef of Alona beach, also known as the "Happy Wall". You can go there by banca, but it is just as easy to swim there from the beach. The conditions are normally calm, without currents, and a visibility of up to 25m. The wall starts at about 3m, and drops down to about 20m, and…

Kan-Uran reef
By boat - CMAS * / OW

Kasai Point cavereefwall
By boat - CMAS * / OW

Katipanan reef
By boat - CMAS * / OW

Kilima Steps wall
By boat - All divers

Kimud Shoal shoalreef
By boat - CMAS * / OW
Kimud Shoal is a sunken island. The top of the island lies at 12-16m, and the steep sides drop off to 200m+. Its main attraction is the school of up to 200 hammerheads, which can usually be seen regularly between December and May, and occasionally through the rest of the year. Hammerheads are more…

Kimut Shoal shoalreefsharkswall
By boat - CMAS * / OW
This is a very small shoal, lost in the sea. Kimut Shoal is for me better than Monad cos smaller and with less divers. Marine life is great and you probably see Thresher Sharks ! Top of the shoal is 15m deep. Pelagic fishes can be seen there.

Kogyo Maru wreck
By boat - CMAS ** / AOW
Located in the east of the south-eastern corner of Lusong Island. South of the Olympia Maru, this Japanese freight ship, 158m (518ft) long with 6.352 G.R.T., was sunk by the Americans in 1944. It lies in a depth of 34m (112ft) on its starboard side. The port side is in 22m (72ft). This is an…

Kon-Tiki reefwall
By boat & from shore - All divers
Very nive corals at 10m deep. Wall is great. For all divers. Biodiversity is great! Watchout for Frogfish, Mandarin fish, Ghostpipe fish, Blue ring octo etc.

Kongs Reef reef
By boat - All divers

Kyokuzan Maru wreck
By boat - CMAS ** / AOW
This Japanese freighter measures about 152 m long and lies almost upright at an average 30m depth; she provides a beautiful wreck dive experience. In excellent condition, this huge sunken ship usually has about 20 metres visibility and ideal diving conditions. In the cargo rooms hold Japanese cars…

Laguna de Boracay reef
By boat - All divers
This dive site is located on the “backside” (east side) of Boracay. It is well-suited for beginners and professionals alike, with a great diversity of clams, anemones, feather stars, butterflyfish, lionfish and sea squirts. The area is quite large, and almost every inch is covered with hard and…

Lapus Lapus reef
By boat - All divers
Lapus Lapus Island has some of the most spectacular coral growth we have ever seen. There is a huge variety of soft and hard coral, in pristine condition. Other marine life includes giant frogfish, painted frogfish, smashing mantis shrimp, various sweetlips, cuttlefish and lionfish. There are many…

Largahan reef
By boat - All divers

Laurel Islands cavereefwall
By boat - CMAS * / OW
Big Laurel and Small Laurel are two separate dive sites which are very similar and quite close to each other. Big Laurel has a tunnel swim-through (8m wide) filled with soft corals and nudibranchs. Both Laurels are sloping walls with healthy corals and prolific fish life.

Layag-Layag bigfishesreefsharks
By boat - CMAS ** / AOW
Pelagics, Nice corals. This dive site is known cos you have good chances to meet the spanish dancer seaslug.

LCU Landing Vessel wreck
By boat - All divers
This vessel is also situated in Triboa Bay but closer to the end of the runway, lies on the edge of a reef with its starboard side lower. Depth is 5-20 meters (25-60 feet) with visibility from 10-16 meters (30-50 feet). This is a great dive for the underwater photographer.

Lighthouse cavelagoon
From shore - CMAS ** / AOW

Lighthouse reefwall
By boat - CMAS ** / AOW
Wall down to 25m, then a plateau at 30m, followed by another wall. Strong currents possible. In winter (Dec. to April) hammerheads and white-tipped reefsharks are possible. In summer they are sometimes seen in deeper areas. Barracuda and jackfish schools. The diveguides find all kinds of strange…

Lighthouse reef
By boat - CMAS * / OW
There are few places in the world where you can see mandarinfish. And even better in Malapascua, Thresher Diver's famous "Randy Mandy" dive will give you mating mandarinfish in their full glory! In the late afternoon we dive Lighthouse, where the rare and psychedelic mandarin fish are virtually…

Lighthouse Wreck wreckreef
By boat - CMAS * / OW
The wreck at Lighthouse was a Japanese World War II landing craft. It was bombed just before landing with a large shipment of cement destined for a gun emplacement. The wreck is in very shallow water - 3m average - and is broken up with the hull in two pieces. The rocks that you will see are…

Ligid Caves ambiancecavereefsharks
By boat - CMAS * / OW
Very nice caves including black corals. Some sharks may be seen around.

Liloan Sogod Bay ambiancebigfishessharks
By boat - CMAS * / OW
This is a very good place to see whalesharks, manta rays, dolphins and of course common sharks.

Liuay Rock reef
By boat - All divers
A low dive, sloping bottom, and a good selection of invertebrates, especially soft corals. Unusual nudibranchs and several species of starfish. Good for novices for general poking around. Ideal for check-out dives.

Lobster Rock shoalreef
By boat - All divers

Logbon Coral Canyon reef
By Boat -
In Logbon Island, An outstanding display of corals and marine life whilst you are diving through valleys and above colorful slopes. Very topographical and scenic dive with good photo and snorkeling opportunities.This spot can be reached in 15 to 20 minutes from Romblon Town or Lonos, Romblon. This…

Logbon Sanctuary reef
By Boat -
In Logbon island. Here you will find several reef sections teeming with colorful marine life to explore. A good place to see big lobsters and cuttlefish. Suitable for all level divers.

Looc reefwall
By boat & from shore - All divers
Nice wall and sandy plateau. Numerous varieties of hard and soft corals, invertebrates...

Luca Sanctuary
From shore - All divers

Ludo cavereefwall
By boat - All divers
Similar as Kon-Tiki.

Luisan Shoal ambiancecavereefsharkswall
By boat - CMAS ** / AOW

Lumayak wall
By Boat - All divers
Very attractive steep wall from 4m to 30m and a snow area in 30m (Black corals forest). It slopes down to +40m. Suitable for beginners when observing the depths limits. Dive ends at dive site Paradise Garden, passing dive site Snappers Cave. Here the main current hits the underwater landscape,…

Lusong Gunboat wreck
By boat - All divers
Located in the southern end of Lusong Island, and northwest of Irako the wreck lies in shallow waters between sea level and 14m. Good for snorkeling and photographing. The wreck was recovered earlier and all the superstructure is gone. It is covered with sponges and soft corals and provides…

Lusong Reef reefdrift
by boat - all levels
The reef itself stretches from the Lusong Wreck to the north, for around 2 sea-miles and offers good to excellent quality of hard and soft corals.Because of the protection of a pearl-farm nearby, it has also a pretty good fish life, including turtles, cattle-fish, rays and plenty of macro-stuff like…

Macklin's Mound bigfishesdeepwall
By Boat - Technical
Macklin's Mound is a deep cleaning station located on the southern walls of Monad Shoal off Malapascua Island.  KNown only to Evolution Resort this pinnacle is one of the best spots for technical divers to see Thresher Sharks.  The mound is at 45 metres and is home to many reef fish and…

Madonna Reef reef
By boat - All divers

Mahaba Sanctuary deepreefsharkswall
By boat - CMAS ** / AOW
Mahaba Island is famous for its sea-turtles. This is a good dive site for snorkelling. There is a tax to access the fish sanctuary (approx 200 pesos / divers).

Mainit drift
By boat - All divers
A nice drift through corals and at the end hot underwater springs.

Mainit drift
By boat - CMAS * / OW

Maite reef
By boat - CMAS * / OW

Malajibomanoc Island bigfishesreefsharks
By boat - CMAS * / OW
Marine Sanctuary. Jacks and snappers shoals. There is also an hot spring near 20m deep!

Mamsa Point reef
By boat - CMAS ** / AOW
Sharks may be seen in deeper water.

Mangrove dive ambiance
By boat & from shore - All divers
We wanted to look at the animals that live in the water under mangrove trees, so we asked a divecenter and they organized a trip to a place close to Sandigan. We did some diving and snorkeling in the mangroves and found many interesting animals, special nudibranchs, a brown sea snake, dragonets and…

Manila Channel reefwall
By boat - CMAS ** / AOW
An abundance of stony hard coral can be found at this dive site. The reef starts in 1m/3' of water and extends out until two small walls are encountered, which drop down to 18m/60'. Several medium sized groupers live here but are difficult to spot since they are well camouflaged and retreat to their…

Mansoud Wall deepreefwall
By boat - CMAS * / OW
Great tunicates fixed to the wall.

Manta Reef reefdrift
By boat - All divers

Mantigue Island bigfishescavereefwall
By boat & from shore - CMAS * / OW
Small caves and short walls. Rabbit fishes, Turtles, barracudas...

Mapating Rock reefsharkswall
By boat - CMAS ** / AOW
This open reef is for experienced divers only and its exploration requires help from local dive guides. The rock itself is surrounded by a fairly shallow area at about 12 meters, ending in a series of drop-offs running down to about 20 meters or more.  Beware of the strong currents. Whitetip…

Mar y cielo reefwall
By boat - CMAS ** / AOW

Maria Elena reef
By boat & from shore - All divers
Great site for Macro-photography.

Maria's point reef
By boat - CMAS ** / AOW
Great diving because of the strong currents here. Clear waters, good corals and an excellent variety of life. For advanced divers only.

Marigondon Cave cavedeepreefwall
By boat & from shore - CMAS *** / Rescue
Cave entrance is 30-38m deep. The cave is 40m long. Need a torch to penetrate the cave. A little North West of the cave it looks flat at 45 meters. Swim out appx 50 meters and there is a new drop off that goes straight down to 72 meters!

Marine Sanctuary reef
By boat - CMAS * / OW
Great dive site. Well known for 'Clownfish city' (only 5m deep).

Marine Station reefwall
By boat - CMAS * / OW

Marissa reef
By boat - All divers
Good corals and marine life. Hawksbill turtles may be seen here.

Masaplod Sanctuary reef
By boat - All divers

Masaplod South reef
By boat & from shore - All divers

Max Climax Wall bigfishesreefdriftwall
By boat & from shore - CMAS ** / AOW

Medicare reefwall
By boat - CMAS * / OW
Gentle coral slope. Turtles may be seen at Medicare quite often :)

Michel Reef reef
By boat - All divers

Moalboal Bay ambiancelagoon
Boat - easy
This is a great muck dive in shallow water (max 4 m) which is best reached by boat. This is a great site to find fish species found on no other sites around Moalboal. Night dives are especially good for exploring the sandy bottom and occasional coral outcrops. Expect to find start gazers,…

Monad Shoal/Shark Point shoalreefsharks
By boat - CMAS * / OW
Monad Shoal is an underwater island on the edge of a 200m drop off, and is famous as the only place in the world where thresher sharks can be seen everyday. This place has a cleaning station for pelagic. Giant manta rays are also a common sight year round. The shoal attracts other pelagics such…

Monkey Wreck deepwreck
By boat - CMAS ** / AOW
A 20m/65' local pig-boat sunk in 1993 lies off the main reef in sand and hosts a large school of batfish and some good-size snappers and groupers. Advanced dive due to depth and since the currents can be very tricky.

Morazán Maru (former Olympia Maru) wreck
by boat - all levels
Freighter and passenger liner built in England, 1908, sold to Central America, where she served (among others) the route between Honduras and New Orleans. Captured by the Imperial Japanese Navy in Shanghai 1941 and used as an Auxiliary Cargo Vessel.The origin of this vessel was for long time unknown…

Mushrom Wall wall
By boat - All divers
At only 10 ft, the shallow roof area turns to a nice wall with fan corals, encrusting sponges, crevices, small ledges and dramatic undercuts, bottoming out at 60 feet. Huge scraps of hard corals (Stag horn, lettuce leaf) with thousands of reef fish separate Mushroom Wall from "The Caves" on its end…

Naguso’s Wall reefwall
By Boat - CMAS * / OW
In Cobrador island.A spectacular wall with colorful sponge and coral display. A large school fusilier fishes dwell in this area, and there are often frog- and stonefish, too. After diving on the wall you go around a corner and come to a beautiful coral field.This spot can be reached in 30 to…

Nalusuan Island reefwall
By boat - CMAS * / OW

Napaling reefdriftwall
By boat - All divers
Napaling can boast a wonderful coral garden, that is ideal for underwater photographers and snorkelers. A dive here normally starts at about 5 to 7 meters, and then drops to about 20 to 30 meters, drifting along the wall. The overhangs are spectacular and you will come across some small caves with…

Napantao Fish Sanctuary bigfishescavedeepreefsharksdriftwall
By boat - CMAS ** / AOW
Napantao is a Fish Sanctuary where fishing is forbidden. There is a tax fee (approx 200 pesos). This is a fantastic wann cover by black corals, with an incredible density of fishs. Pelagic can be seen off the wall. The top of the wall is covered by Tubastrea sp. The dive site is very different…

Napoleon Wall wall
By boat - All divers
On the edge of the wall at 30 m big schools of snappers and mackerels can be watched, although the big attraction of this dive site are the big napoleon wrasses reaching up to 1,5 m in length, which often come for a visit. Tunas and trevallys are common visitors to this reef that is overgrown with…

Neptune House cavereef
By Boat - CMAS ** / AOW
This diving spot is a Cave. The entry into the cave starts at 31m, time to spend in the cave 8-10 min. Sometimes you can find the sleeping Neptune, but for sure several Lobsters, fishes looking for protection, and other night active animals. There's a Chimney to the outside of the cave: getting up…

Neptune's Land reef
By boat - All divers
This dive is a flat plateau connecting Napoleon Wall and the Coral Garden east. As the name indicates Neptune cups to a considerable size can be found. Also turtles seem to favor this place.

North Atoll - Amos Rock ambiancebigfishesreefsharksdriftwall
by liveboard - cmas**/ AOWD
The wall is wonderfully covered with huge gorgonian fans and whip corals and if there is some current this place is just packed with large fish! Here you can see so many sharks you'll give up on counting, mostly white tip reef sharks and gray reef sharks. There are also plenty of mackerels,…

North Atoll - Bird island reefwall
by liveboard - all levels
This is a steep wall with overhangs, swim throughs and crevices. Some areas have sand trickling down from above like a waterfall and there is a corner where you feel strong currents coming from both sides. The reef top is quite nice with lots of hard coral heads and sandy areas in-between. There are…

North Atoll - Gorgonian Channel bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

North Atoll - Malayan Wall bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

North Atoll - Malayan Wreck wreckreef
By boat - CMAS ** / AOW
You can see the remains of a Malayian ship that stranded here from the mooring place. You can have a strong current in one of the sides, but lots of fish will hang around there too, a large group of dogtooth tuna and even an eagle ray. On the reef top you can see moray eels, angelfishes,…

North Atoll - Marine Park bigfishesdeepsharksdriftwall
By boat -

North Atoll - Ranger Station bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW
There is a channel going to the ranger station.

North Atoll - Seafan Alley bigfishesdeepreefsharksdrift
By boat - CMAS ** / AOW

North Atoll - Shark Airport bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

North Atoll - South Rock bigfishesreefwall
by liveboard - all levels/ AOWD
Steep wall with a lot of gorgonian fans, and some overhangs. It's easy to encounter large group of tunas and longface emperors. On the sandy areas there are always a lot of sea cucumbers like the special looking Thelenota ananas. As during nearly every other dive, there are several turtles.

North Atoll - Terraces bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

North Atoll - Wall Street bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

North Atoll - Washing Machine bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

North Point reef
By boat - CMAS * / OW
Beautiful soft coral and varied marine life including frogfish of different colors, fire urchin hikers specially zebra crabs, candy crabs, and nudibranchs. Great macro. An amazing hangover (see left) could easily keep you busy for the whole dive.

North Rocks driftwall
By boat - CMAS ** / AOW
Expert back-up both above and under water is required. A slope runs to 15 meters ending in a wall which seemingly has no base due to its depth. Big snappers and grunts that do not seem to favor the southern reef can be seen around the North Rock. Sharks are a common sight but pelagic fish might not…

North Wall wall
By boat - CMAS * / OW
This is a short wall at 24m, about 10m long by 6m high. Its nooks and crannies hide a wide variety of life including giant frogfish and nudibranchs. After investigating the wall, swim out from the wall into a sandy area which is home to a field of sea pens and many other critters, then let yourself…

North Wall wall
By boat - All divers
A sheer drop from about 7- 35 m makes that place an interesting dive site. Although not as many fish as in other parts of the island can be seen, the overhanging corals create a very special atmosphere. Pelagic fish such as tuna and mackerel are frequent.

Nunez Shoal reef
By boat - CMAS * / OW
A stunning wall dive, Nunez Shoal hosts a wide variety of life. As you approach the wall and drop off, look ahead into the sandy areas for groups of garden eels. As you drop over the wall, look out into the blue for pelagics such as eagle rays and sharks, and along the wall you can spot white eyed…

Oakita Maru wreck
By boat - CMAS *** / DiveMaster
This wreck, just off Malapascua, is variously called the 'Pioneer' (it isn't) and the 'Unknown Maru'. Terry Dukes found a reference to a Japanese Personnel Carrier, 'AP Oakita Maru' sunk on 12th September 1944 at coordinates close to the wreck site (N 11-21; E 124-07 reference The Official…

Octopus Wall wall
By boat - All divers
Small wall with pretty growth, octopuses, scorpion fish, sponges, tubastrea, continuous into a slope to the north with some strange crinoids covered formations provide a very scenic view of rudderfish, groupers, etc.

Odie's Dingding wall
By boat - CMAS ** / AOW
A recent addition to the local dive sites, this is an 8m/25' high wall located off Manila Channel. The wall is covered with 3m/7' gorgonian sea fans and large black coral trees, not seen at other dive spots in the locality. Numerous small holes in the wall are home to eels and blue-triggerfish.…

Okikawa Maru (former Taiei Maru) wreck
By boat - CMAS ** / AOW
This was a civilian tanker/oiler ordered form Mainila to Coron Bay on the 22nd September 1944. Two days later, she was hit by bombs and sank. She is 160m long and lies two miles south of Concepcion in the northwest of the bay. Confusion has reigned for a while about its true name. Many called it The…

Old Volcano ambiancebigfishesdeepreefsharks
By boat - CMAS * / OW
Sharp pinnacles formed by the volcano lava. Great marine life including soft corals, Pygmy Seahorse, Ghost Pipefish, Batfish, Garden Eels, White tip Sharks, and Frogfish. Unexpected Manta & Eagle Rays!

Olo reefdriftwall
By boat - CMAS ** / AOW
Good corals. Sharks may be seen in deep water.

Olympia Maru (former Tangat Wreck) wreck
By boat - CMAS ** / AOW
Located in between the northern tip of Lusang Island and the island of Tangat, this originally thought japanese freight ship, 137m (449ft) long with 5.617 G.R.T, was sunk by the Americans in 1944. The reality is that nobody knows his origin, but it was supposedly built in Europe. The Olympia Maru…

Origon Rocks reef
By Boat - CMAS * / OW
A true diver’s paradise! Situated in a depth of 10 to 25 meters and surrounded by clean sand, you will find a spectacular reef covered in table, tube and soft corals, teeming with marine life. Outstanding bottom topography makes for great photo opportunity.This spot can be reached in 50 to 70…

Ormoc Shoal shoalreefsharks
By boat - CMAS ** / AOW
Far from the common hotels. This sandy plateau has great corals (tubastrea coral, acropora, montipora and digitala).

Oryoku Maru wreck
By boat - All divers
The Oryoku Maru was a Japanese ship sunk by United States Navy fighter planes during World War II. Oryoku Maru left Manila on December 13, 1944, with moe than 1620, mostly American, prisoners of war (POWs) packed in the holds. US Navy planes from the USS Hornet attacked the unmarked ship, over the…

Paliton Staghorn reefwall
By boat - CMAS * / OW
Nice coral structures.

Paliton Wall reefwall
By boat - CMAS * / OW

Pamilacan Island wreckreef
By boat 1h - CMAS ** / AOW
by boat from Alona beach. Pamilacan island is often combined with Snake island. A very overfished site, that has no fishlife over 20 cm. Many divecenters dont go there anymore because of the lack of fish. Not a very interesting dive anymore.

Panagsama Beach reefwall
By boat - CMAS * / OW
Dive site in in front of the two warfs and the jetty.

Panorama reefwall
By Boat - All divers
Steep wall 3m to more than 30m. Limited suitable for beginners. Nicely populated steep wall with a panoramic view into the open water. Open for divers only since 2001 and specially protected by Marine Park regulations.

Paradise Garden reefwall
By Boat - All divers
the best snorkeling spot of all. fantastically populated wall from 3 to 30 m. Suitable for beginners when observing the depths limits. Here you can follow the typical V profile, or perform a more than 2 hours shallow (about 8 m) dive. Unique coral landscape. Chances of big fish. Wide lens area for…

Parker reefwall
By boat - All divers

Patrol Boat wreck
By boat - All divers
This vessel is situated in Triboa Bay at a depth of 20 - 25 meters (60-75 feet). Sitting upright the wreck is a great dive with visibility from 7-13 meters (20-40 feet)and plenty of marine life. We have placed a cable from the bow of the ship across to the coral reef where the divers can finish…

Pescador Island bigfishescavedeepreefsharkswall
By boat - CMAS * / OW
Pescador island is a marine sanctuary. You can dive several times here, best is the S part. There is a steep wall with a cave named cathedral in the NW side. The major attraction at this island is the resident schools of sardines that must number in the tens of thousands. These small fish attract…

Peter's mound ambiancebigfishesdeepsharksdriftwall
By boat - CMAS ** / AOW
Good site to meet large pelagics.

Peter's Pinnacles bigfishesdeepreef
By boat - CMAS * / OW
This dive consists of three large pinnacles with a minimum depth of 15 meters and a maximum depth of 39 meters. Here you might spot Eagle Rays, Mantas, sharks and possible Whale Sharks.This spot can be reached in 50 to 70 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12…

Phil's Fan Coral Collection deepreef
By boat - CMAS ** / AOW
One of the more deeper dives on Romblon. Here you will slope down to a maximum depth of 35 meters to where you will find a formation with lots of spectacular big Gorgonias. Beautiful dive with abundant marine and coral life. Recommended for intermediate and advanced level divers only.This spot can…

Pink Wall reef
By boat - CMAS * / OW
An overhang which, when dived on the correct tide, is perfect for novices and photographers. Surface conditions can be a little rough. Good night dive.

Pioneer Wreck wreck
By boat - CMAS *** / DiveMaster
Torch is strongly recommended, as well as a serious deep dive experience! Because it is so deep, this Japanese World War II wreck is still in great condition. It was a gunboat in the war, and as you descend, you will see the guns pointing upwards towards you! It is about 60m long, in the upright…

Pogaling reef
By Boat - All divers
Simple shallow (max. 14m) dive. Large area of stone coral forest with small channels to pass. Open for divers only since 2001 and specially protected.

PPB Peak Performance Buoyancy
boat - easy
PPB Peak Performance Buoyancy or Raypoint A sandy slope with sea gras and many anemone fish, with shrimps living in the anemone. Common sights are frog fish, sand eels and bluedotted stingrays. The dive site is mainly for macro life. Highlights include sea moth, star gazer, various types of…

Pungtud Wall reefwall
By boat - All divers
Pungtud wall is a beautiful coral garden, which starts at 2 meters, and slopes down to about 20 meters. You'll need a banca to bring you here, but it is great for snorkeling as well as for diving. Although currents can be strong, you will normally only go there when conditions are calm. There are…

Punta Bunga reefwall
By boat - All divers
This site is the start of a series of walls which connect to Yapak. The drop-off is filled with cubbyholes where moray eels, lionfish, groupers and triggerfish reside. Stingrays are usually seen on the sandy bottom at 24 meters.

Pura Vida Housereef
By boat & from shore - All divers

Quiliano reef
By boat - CMAS * / OW
A beautiful site with better than average visibility and fish life, soft corals, spearing mantis shrimp, pygmy sea horses and a lot of macro.

Rico's Wall reefwall
By boat - CMAS * / OW
Rico's Wall has a wonderful coral garden on a shelf from 7 meters to 11 meters. At the edge of the coral garden is a wall that drops down to about 35 meters. In the coral garden you can find a bounty of nudibranches, sea stars, crinoids, hydroids, all types of smaller reef fish, anemones with…

Robs Reef deepreefwall
By boat & from shore - All divers
25 meter wall starting in 5 meters of water extending for several hundreds of meters.

Rock Point reef
By boat - CMAS ** / AOW
Two dives are possible at Rock Point: The E side and the W side of the cape. The E side goes deeper...

Rock Point East reef
By boat - All divers

Rock-Point cavereefwall
By boat & from shore - All divers
Rock point borders a protected underwater area.

Romy's Reef reef
By boat - All divers
Plenty of coral mounds, with enormous basket sponges, a fine and nice selection of reef fish and invertebrates. Sightings have been reported of blue spotted rays and a few turtles. Some coral damage and unfruitful areas though; eastern area though has massive coral thickets and extends through to…

Rudy's Rock shoalreefwall
By boat - CMAS * / OW
Rudy's rock is much the same as Rico's Wall. Both sites are actually connected. Here you also have a chance of coming across large green turtles, who frequent this location, and also run into a huge shoal of big eye trevally. They will circle around you for some time.

Sabang Junk reef
By boat - All divers
An old wooden fishing junk sunk off the front of Sabang beach in 1993. A resident school of very friendly batfish and large surgeonfish make this a popular dive. Surrounded by sand, the wreck has attracted many eels, large lionfish, damsels, trumpets, and the occasional stonefish. Flounders and…

Sabang Point wall
By boat - All divers
A good wall dropping down to 24m/80', with stony corals, soft corals many fish and unusual invertebrates such as large cuttlefish and octopus. A ridge rising to 5m/15' is covered with more crinoids that are colourful and corals. A good night dive.

Sabang Wrecks wreck
From shore - All divers
3 wrecks have been sunk to create an artificial reef system.

Salagdoong reef
By boat - All divers
Gradual slope from large semi-submerged rocks. Lots of invertebrates such as butifull corals, soft corals and also staghorns, pipes, tunicates and sometime blue spotted rays and turtles.

Salvo Beach ambiancereeflagoon
From shore - Introductory dives and OW
Also known as Three P's housereef.Salvar Beach is a shallow shore dive situated a few meters from the Three P Holiday & Dive Resort. With a maximum depth of 20 meters, excellent visibility, low currents, interesting underwater landscapes and abundant marine life like different moray eel…

Sammar Sanctuary reef
By Boat - CMAS * / OW
This site contains some really interesting sea life. This is a good place to find hidden smaller animals.This spot can be reached in 30 to 45 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.

Sampaguita ambiancedeepreefdriftwall
By boat - All divers

San Pedro Cliff reefdriftwall
By Boat - CMAS ** / AOW
An area of steep vertical walls and boulders. There are often some currents present which make this perfect for a drift dive. This dive site provides an exciting dive and also attracts some interesting marine life, various reef fish, rays and turtles. San Pedro Cliff hosts a large field of garden…

San Pedro Sanctuary reef
By Boat - CMAS * / OW
Well known and famous for the large amounts of inhabiting turtles to be seen here. This also happens to be the biggest attraction to this site. The reef here boasts some of the best coral formations and marine life to be seen in Romblon Island. Suitable for all level divers. Whale Sharks were…

San Ricardo Whale Sharks ambiancebigfishesdrift
By boat - All divers
San Ricardo is the place to meet Whale Sharks. The best is not to dive but meet the sharks by snorkeling ! Spotters from Sunok fishing village can help to find sharks.

Sanctuary reef
By boat - All divers
As far as I know, this dive site is still FORBIDDEN !

Sand Bar reef
By boat - All divers

Santa Cruz reefwall
By boat - CMAS * / OW
Nice sandy slope. Many small invertebrates to look for.

Santa Maria reef
By boat & from shore - All divers
Look for garden eels at the 20m sandy floor.

Sasaigang Point reef
By Boat - CMAS * / OW
Situated on the tip of Logbon Island a small rocky island just off the coast of Romblon. This dive starts in a depth of 3 meters and gently drops to a depth of 15 meters where you will find some of the most prolific corals. Ideal for photography and beginner divers to explore.This spot can…

Sawang reef
By boat & from shore - All divers

Seiun Maru wreck
By boat - CMAS * / OW
This vessel is situated between Alava Pier and the northern end of the runway. A Japanese cargo vessel of approximately 30,000 tons sunk by the American Navy in 1945, the Seian Maru lies on its portside in 27 meters (85 feet). As you swim through its cavernous holds, you will encounter talakitok,…

Sepok Wall reefwall
By boat - CMAS * / OW
The rim of the drop-off due west of Sepok Point and running southwest is a very good divesite with a wide variety of marine life. A great number of small reef fish dart in and out of the numerous corals along its vertical wall.

Shangri-La House Reef reef
By boat & from shore - All divers
A classic dive of Mactan island. Ghost pipefish can be seen there.

Shark Cave reef
By boat - CMAS ** / AOW
A large overhang, which is a favourite spot for white-tip reef sharks to rest during the day. Also home to Blue Spotted Sting Rays, Moray Eels and Octopus. Usually visited at the beginning of a multilevel dive o the Pink Wall or as a stop on the way to the Canyons. Good for Nitrox.

Shark view point reefsharkswall
By boat & from shore - CMAS ** / AOW
The plateau is 30m deep. In this area, there is always a little bit current. This IS the place to see hammerheads and white-tipped reefsharks (in winter). You may also find Pygmy and Thorny seahorses.

Ship Wreck wreckreef
By boat & from shore - CMAS ** / AOW

Shore Diving
Shore - CMAS * / OW

Sinandigan Wall wall
By boat - All divers
A real wall goes down to 40m/130', with all manner of corals plus at least seven different varieties of nudibranchs and plenty of larger fish.

Snake Island reefdrift
by boat 40-50 min from Alona beach - CMAS ** / AOW
This is a sunken plateau about 18m deep, lying in the south of Pamilacan, covered with corals. This dive site lies in the middle of the ocean and usually there is a very strong current. Plan your dive, jump in on the side the current comes from and then sweep over the plateau with it. We saw 8…

Snappers Cave cave
By Boat - CMAS ** / AOW
very attractive steep wall from 4m to 30m and a wide cave in 27m. Suitable for beginners when observing the depths limits. Good for preparation to dive site Neptune House. The dive connects to dive site Paradise Garden. The experienced diver can enter the cave. Light obligatory. Attention: There is…

Solangon reefwall
By boat - All divers

Sombrero Island deepreefsharksdriftwall
By boat - CMAS ** / AOW
On the surface, this island resembles a hat underwater, so its profile make the name Sombrero even more appropriate. The rim of the "hat" stretches a long way underwater from north to south. Gorgonians, black coral, shells, turtles, rays, grunts, jacks, snappers, and a great variety of soft…

South Atoll - Black Rock bigfishesdeepreefsharksdriftwall
by liveboard - CMAS ** / AOW
Steep wall not covered with much corals. In-between sandy channels coming from the reef top. There are some sharks patrolling, mostly white tip reef sharks and a few Napoleon wrasses. Sometimes mantas are spotted in this area.

South Atoll - Black Rock North bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

South Atoll - Delsan Wreck wreckreefdrift
By boat - CMAS ** / AOW

South Atoll - Eiger Wall bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

South Atoll - Garden Wall bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

South Atoll - Light House End bigfishesdeepreefsharksdriftwall
By boat - CMAS ** / AOW

South Atoll - Lighthouse bigfishesreefsharksdriftwall
by liveboard - CMAS ** / AOW
Steep wall and a large reef top area. Hard and soft corals, anemones with anemone fishes, lots of anthias.

South Atoll - South West Wall reef
By boat - CMAS ** / AOW
An array of staghorn coral on a short slope runs down to 15 meters and the start of the drop-off. Rainbow runners and jewfish frequent the area.

South Islet drift
By boat - CMAS ** / AOW
This area presents good drift-diving opportunities. A wide range of pelagic fishes can be seen in the drop-off, which has a depth in excess of 60 meters. Moorish idols, and crayfish can be observed in great numbers. Snorkeling is possible around the stern of the wrecked log carrier, the Delsan, but…

South point shoalreef
By boat & from shore - CMAS ** / AOW
Great coral garden with giant table corals (between 5 and 15m). Large fish shoals. Lots of caves and overhangings with sometime White Tip Sharks.

St Christopher wreck
By boat - CMAS ** / AOW
A retired 20m live-a-board dive boat sunk off the end of the El Galleon Pier in 1995, this is good start to begin exploring the reef fronting Small Lalaguna Beach. After some time enjoying some large snapper that live on the wreck, the current will propel you up to another wreck, The Speedboat, in…

Sumilon Island ambiancecavereefsharkswall
By boat - All divers
Many small caves, nice dive.

Sunken island shoalbigfishesreefsharks
By boat - CMAS ** / AOW
This site is well known for its large fish shoals, sponges and gorgonians. Lot of Lion Fishes are on the S side. A must!

Sunken Island shoal
By boat - CMAS ** / AOW
The top of the shoal is about 12m deep.

Sunken Island reefwall
By boat - CMAS * / OW
Also known as Takot Reef.As the name tells this is basically a beautiful submerged island covered in corals. Starting at 10 meters sloping down to 30 meters. Whilst diving around the island you can find many different fish species, nudibranchs and cuttlefish. This site also provides great photo…

Sunken Yatch wreckreef
By boat - All divers
Sandy/muck dive area

Sunok bigfishescavereefdrift
By boat - CMAS * / OW
Access to Sunok dive site is with boat local dive operator Sogod Bay Scuba Resort. Contact www.sogodbayscubaresort.com

Sydney Park reef
By boat & from shore - All divers

Tagbao Island (Miniloc) reef
by boat - all levels
Off the northwest point of Miniloc, this tiny island is also known locally as Tres Marias in reference to the three reefs that lie between the two islands. As it's shallow here, snorkeling is good and beginner divers can expect to see lots of reef fish, colourful corals and painted crayfish.

Tagtuan Reef driftwall
By boat - CMAS ** / AOW

Talei Maru/ Concepcion Wreck wreck
By boat - CMAS ** / AOW
Located in the south of the village of Concepcion on Busuanga Island edging at the pearl farm of the Lusteveco Company. The wreck is not visible any more above sea level. The 168m (551ft) long Japanese 10.045t auxiliary tanker Taiei Maru was sunk in 1944 by American planes. It lies almost straight…

Talisay tree reefwall
By boat & from shore - All divers
See fallen tree. It's the same kind of dive.

Talisay Wall deepreefwall
By boat - CMAS * / OW

Tambuli wreckreef
By boat & from shore - All divers
There is a small airplane at the end of the slope (22m deep), surrounded by truck tires.

Tangub Hot Springs reef
By boat - CMAS * / OW
Dark sand terraces with great soft corals. The hot spring is not underwater but located on the shoreline.

Taplion Wreck wreck
By boat - CMAS ** / AOW
The 'Taplion' Wreck, is an unidentified World War II Japanese cargo carrier, named for the nearby town on the mainland. The boat was hit by torpedoes and although it lies in several sections, it is still recognizable as a vessel. There is an abundance of life on this wreck and it is covered in…

Tarok bigfishescavedeepreef
By boat - CMAS *** / DiveMaster

Tauma reefwall
By boat - CMAS * / OW

Telsie's Garden ambiance
From shore or by boat - CMAS * / OW
Telsie’s Garden is a muck site right in front of the village Agpanabat. This site includes a rich sandy slope with scattered coral and some rubble areas. This is an excellent muck site with many different species of cephalopods, nudibranchs and different fish species.This spot can be reached in 40…

The Atoll reef
By boat - CMAS ** / AOW
Rising from 33m/110' to 20m/65' this large rock has several small crevices on the bottom side where reef sharks and stingrays can often be found. On the other side, the rock overhangs making it a good place to explore with a flashlight with many eels, lionfish, nudibranchs and octopus. A large…

The Blue Holes ambiancecave
By boat - CMAS * / OW
The Blue Holes is a dive site that consists of 3 large holes in the coral that lead to an open topped cavern. It's a very unusual and interesting underwater structure and you can observe white-tip reef sharks. The crystal clear water here guarantees good visibility.

The Canyon reefdrift
by boat - cmas**/ AOWD
This is an impressive reef called the Canyon: it starts at a depth of 10 to 15 feet (3 to 4 meters) , dive towards the reef, where the Canyon gets deeper and the the current makes a good opportunity for a drift dive. You can see lots of marine life and coral.

The Canyons reefwall
By boat - CMAS ** / AOW
An advanced dive that requires a good dive guide to allow for the currents to sweep you into position. Racing over several small drop-offs below the Hole in the Wall covered in soft corals and sponges, you can duck into and one of the Canyons for a respite from the current. There is much to find on…

The Caverns cavewall
By Boat - All divers
Start like dive site Wonder Wall, but southerly direction. Simple dive site, nice steep wall and many grottos. Suitable for beginners when observing the depths limits. Many different fish, chance to meet "Bruno", a giant octopus.

The Caves wall
By boat - All divers
Striking walls drop to an average of 60 degrees where there is a sandy bottom and a series of caves occupied by sweepers, soldier fish, puffer fish, and sea plumes. Some nice bushes of black coral are seen here. Night diving is impressive with Spanish dancers, sleeping fish and a wide diversity of…

The Classroom reef
By boat - beginners
On the west side of the island, right in the middle of this confusion of corals and color is a clearing with white sand at 3 meters (10 feet) of water. This is the site called the classroom, indeed a very ideal place to teach scuba.

The Drop Off - Verde Island wall
By boat - All divers
Pinnacles reach the surface on the East side of Verde Island and drop away to great depths. A vertical reef with some nice gorgonian fans, sea snakes and frogfish and some large pelagic schools. Current can be tricky. Volcanic bubbles rise through the table coral at the safety stop.

The Gardens reef
By boat - All divers
A sequence of coral gardens, small walls, sandy area with coral heads and slopes with soft corals. Plenty of anthias, hawk fish, and invertebrates. Good for snorkeling and for trainee or beginner in diving.

The Laberinth ambiance
by boat - all levels
This is a boulder formation creating a special environment underwater. One can dive trough the narrow corridors they create, and the occasional swim-through. Some macro life can be found here.

The Mogami Maru wreck
Easy - Technical Dive Only
The Mogami Maru is a Japanese fishing trawlor refitted for combat in WWII.  Sunk in 1944, probably from aerial attack, the 50m wreck lies upright on her keel.  The wreck is home to many genuine artifacts of the crew who died with her.  It is a technical dive only and should not be…

The Pier reef
By boat & from shore - CMAS ** / AOW
Industrial Pier - Restricted Access for dive centers which got a permit to dive there. Since December 2008 the pier is in renovation and it's not yet sure, if the site will still have the biological diversity from before. On the last dive there had been many different kinds of frogfishes (pink,…

The Wall wall
By boat -

The Wall (Miniloc) reefwall
by boat - all levels
This is one of the most popular dives in El Nido. This wall drops off for around 30m, and it's all covered with soft corals and plenty of nudibranchs.

The Washing Machine - Verde Island
By boat - CMAS ** / AOW
A high-voltage dive made over a series of seven shallow gullies with the current taking your bubbles in all directions, and throwing you around. Requires a good guide and some experience of current diving. Made at slack tide it is an easy dive.

The Wreck wreck
By boat - All divers
Seven year old sunken passenger liner with bottom depth of 180 feet, and 130 feet at its highest point. Big schools of fish from deck such as black and white snappers, red snapper, jacks, and groupers. Great visibility. For adventurous, experienced divers.

Three Coconuts reef
By boat - CMAS ** / AOW
On the western side of Cabilao Island is Three Coconuts. Major attractions to be found in this dive spot are large table corals. Like the Lighthouse, the depth for Three Coconuts is at five to 50 meters. Even though the corals take center stage in this dive site, other marine life also abound here…

Times Square deepreef
By boat - CMAS * / OW
In Banton Island.Due to its location Patrick’s Times Square is a rather remote dive. Despite the fact that this site is not dived often, it remains one of the most beautiful sites with great snorkeling opportunity and pristine undisturbed reefs. Abundant marine life. Great photo opportunity. A…

Tingo Point reefsharkswall
By boat - CMAS * / OW
There are many chances to see Thresher Sharks in the morning.

Tinoto Wall deepreefwall
By boat - CMAS * / OW

Titanic Rocks cavereef
By Boat - All divers
Between the titanic rocks there is a lot of life to discover, also an interesting cave in only 14m depth. Very interesting snorkel place!!!

Tonga Point reefwall
By boat & from shore - All divers
This dive site is normally calm but there can be very strong curents sometimes... There is a gentle slope down to 12m that leads to a huge drop-off that goes more than 65m ! Many beautifull corals (including leather corals, soft-corals), fansand sponges and lots of colorful fire hydroids.…

Tongo point cavedeepsharkswall
By boat - CMAS ** / AOW
Turtles are often seen at Tongo point

Tuble Reef cavereefwall
By boat - All divers
Nice dive site for second dive. There is small caves at 27-30m deep.

Tulapus reef
By boat - CMAS * / OW

Tulobhan Reef reefdrift
By boat - All divers
Although it is quite shallow, a slow steady current usually allows drift diving to cover a wide area. Sea snakes are common, while sea cucumbers, eels and feather stars can be seen waving in the current.

Turtle Reef reef
By boat - All divers
Ancient sea turtles swims beside a coral reef garden in Palawan.

Turtle Rock shoaldeepreefsharks
By boat - CMAS ** / AOW
Large coral rock covered with gorgonians.

Turtles' Feeding Place reef
By boat -
Turtles’ Feeding Place contains coral formations in a depth between 5 and 25 meters. Normally with a mild current and good visibility. Turtles can also be spotted here, with many shoals of fusiliers buzzing around.This spot can be reached in 10 minutes from Lonos, Romblon or 20 minutes…

Twin Rocks (Miniloc) reef
by boat - all levels
On the north side of the island, this site again slopes from 13-21m and has a sandy bottom. It is charactarised by a profusion of table corals, sea whips and sponges. You will see small stingray and angelfish here.

Two Holes shoalbigfishesdeepsharkswall
Boat - AOW
Two Holes is named after the two swim throughs in the plateau top of Monad Shoal.  Two Holes is a known cleaning station frequented by Thresher Sharks and Devil Rays at dawn.  It is also an excellent big fosh dive with resident white tips, groupers and sweetlips always hanging around.…

Unknown Wreck deepwreck
By boat - CMAS *** / Rescue

USS New York wreck
By boat - CMAS * / OW
USS New York has been transformed into an artificial reef. The growth of the tourism industry has expanded and Subic Bay has become an upcoming dive vacation location. The New York has become one of the most dived ship wrecks in Asia, given her somewhat shallow depth (18 to 27 meters), ease of…

Verde Island Wall deepwall
By boat - CMAS ** / AOW
Verde Island Diving is excellent, with warm water, 30m plus on average visibility and good fish and coral life all add up to a world class destination. Depending on state of tide the current on the wall face can be nothing to very strong >3 knts and very easy to miss the duck back around/over…

Virgen East House Reef reefwall
By Boat and shore - All divers
Our house reef. Also here the steep wall is densely populated by Corals. Limited suitable for beginners because of depths and currents. Rich fish life. Chances of turtles

Virgin Drop wall
By boat - All divers
This wall dive is ideal for deep dive training. Large sea fans and crinoids provide colourful hiding spots for bass, moray eels and nudibranchs. Rays are sometimes seen gliding through the thermoclines during tidal changes.

Virgin Island ambiancecavedeepreefdriftwall
By boat - CMAS *** / Rescue

West Escarceo reef
By boat - All divers
A dive site suitable for all levels. The reef starts in shallow water and follows a steep slope down to 30m/100' . Depending on the current you may find yourself being propelled towards the Canyons or the Hole In the Wall or simply hanging amongst the schools of fusiliers and tunas. Always lots to…

West Point cavereefwall
By boat - CMAS * / OW

Whale Rock reef
By boat & from shore - All divers

White beach reefwall
By boat - CMAS * / OW

White Beach
From shore - CMAS * / OW

White Island Black Forest ambiancedeepreefwall
By boat - CMAS * / OW
Black corals 'forest' on white sand with stingrays!

White Island reef reef
By boat - CMAS * / OW

Wonder Wall cavewreckwall
By Boat - All divers
Simple dive site, nice steep wall and grottos. Suitable for beginners when observing the depths limits. A small wreck and fresh water source in 27m.

Wreck Point wreckreef
By boat - All divers
Excellent corals lead down from the large wreck that is actually positioned on the rocks at the surface. Very nice hard corals and all the expected fish make this a good dive for novices and photographers.

Yapak bigfishessharkswall
By boat - CMAS ** / AOW
Yapak 1 and 2 are actually two separate walls which begin at 30 meters and drop down to 70 meters. The most famous of Boracay’s dive sites, close encounters with white tip and grey reef sharks, dogtooth tuna, groupers, napoleon wrasses and giant trevallies are common. Surface conditions can be…